SCOPe 2.05: Domain d1qcfa1: 1qcf A:80-145

Lineage for d1qcfa1 (1qcf A:80-145)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein Hemapoetic cell kinase Hck [50062] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50063] (20 PDB entries)

8. Domain d1qcfa1: 1qcf A:80-145 [24498]
   Other proteins in same PDB: d1qcfa2, d1qcfa3
   complexed with pp1

Details for d1qcfa1

PDB Entry: 1qcf, 2 Å

PDB Description: crystal structure of hck in complex with a src family-selective tyrosine kinase inhibitor

PDB Compounds: (A:) haematopoetic cell kinase (hck)

SCOPe Domain Sequences for d1qcfa1:

Sequence; same for both SEQRES and ATOM records:

>d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
sgiriivvalydyeaihhedlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarv
dslet

Timeline for d1qcfa1:

• d1qcfa1 first appeared (with stable ids) in SCOP 1.55
  
• d1qcfa1 appears in SCOPe 2.04
  
• d1qcfa1 appears in SCOPe 2.06
  
• d1qcfa1 appears in the current release, SCOPe 2.08