![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (15 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.2: SH3-domain [50044] (1 family) ![]() |
![]() | Family b.34.2.1: SH3-domain [50045] (33 proteins) |
![]() | Protein Hemapoetic cell kinase Hck [50062] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50063] (6 PDB entries) |
![]() | Domain d1qcfa1: 1qcf A:80-145 [24498] Other proteins in same PDB: d1qcfa2, d1qcfa3 complexed with pp1; mutant |
PDB Entry: 1qcf (more details), 2 Å
SCOP Domain Sequences for d1qcfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens)} sgiriivvalydyeaihhedlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarv dslet
Timeline for d1qcfa1: