Lineage for d1qcfa1 (1qcf A:80-145)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 372425Fold b.34: SH3-like barrel [50036] (15 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 372467Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 372468Family b.34.2.1: SH3-domain [50045] (33 proteins)
  6. 372620Protein Hemapoetic cell kinase Hck [50062] (1 species)
  7. 372621Species Human (Homo sapiens) [TaxId:9606] [50063] (6 PDB entries)
  8. 372622Domain d1qcfa1: 1qcf A:80-145 [24498]
    Other proteins in same PDB: d1qcfa2, d1qcfa3
    complexed with pp1; mutant

Details for d1qcfa1

PDB Entry: 1qcf (more details), 2 Å

PDB Description: crystal structure of hck in complex with a src family-selective tyrosine kinase inhibitor

SCOP Domain Sequences for d1qcfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens)}
sgiriivvalydyeaihhedlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarv
dslet

SCOP Domain Coordinates for d1qcfa1:

Click to download the PDB-style file with coordinates for d1qcfa1.
(The format of our PDB-style files is described here.)

Timeline for d1qcfa1: