Lineage for d1qcfa1 (1qcf A:80-145)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2783072Protein Hemapoetic cell kinase Hck [50062] (1 species)
  7. 2783073Species Human (Homo sapiens) [TaxId:9606] [50063] (26 PDB entries)
  8. 2783082Domain d1qcfa1: 1qcf A:80-145 [24498]
    Other proteins in same PDB: d1qcfa2, d1qcfa3
    complexed with pp1

Details for d1qcfa1

PDB Entry: 1qcf (more details), 2 Å

PDB Description: crystal structure of hck in complex with a src family-selective tyrosine kinase inhibitor
PDB Compounds: (A:) haematopoetic cell kinase (hck)

SCOPe Domain Sequences for d1qcfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
sgiriivvalydyeaihhedlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarv
dslet

SCOPe Domain Coordinates for d1qcfa1:

Click to download the PDB-style file with coordinates for d1qcfa1.
(The format of our PDB-style files is described here.)

Timeline for d1qcfa1: