Lineage for d1aey__ (1aey -)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 109314Fold b.34: SH3-like barrel [50036] (9 superfamilies)
  4. 109356Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 109357Family b.34.2.1: SH3-domain [50045] (20 proteins)
  6. 109373Protein alpha-Spectrin, SH3 domain [50058] (1 species)
  7. 109374Species Chicken (Gallus gallus) [TaxId:9031] [50059] (10 PDB entries)
  8. 109381Domain d1aey__: 1aey - [24496]

Details for d1aey__

PDB Entry: 1aey (more details)

PDB Description: alpha-spectrin src homology 3 domain, solution nmr, 15 structures

SCOP Domain Sequences for d1aey__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aey__ b.34.2.1 (-) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus)}
gkelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevndrqgfvpaayvkkld

SCOP Domain Coordinates for d1aey__:

Click to download the PDB-style file with coordinates for d1aey__.
(The format of our PDB-style files is described here.)

Timeline for d1aey__: