Lineage for d2znla_ (2znl A:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2223731Fold e.77: PA C-terminal domain-like [254112] (1 superfamily)
    Pfam PF00603; PubMed 18615018; complex fold with N-terminal a+b domain and C-terminal all-a domain
  4. 2223732Superfamily e.77.1: PA C-terminal domain-like [254132] (1 family) (S)
  5. 2223733Family e.77.1.1: PA C-terminal domain-like [254167] (2 protein domains)
  6. 2223737Protein automated matches [254658] (4 species)
    not a true protein
  7. 2223740Species Influenza A virus [TaxId:211044] [255729] (1 PDB entry)
  8. 2223741Domain d2znla_: 2znl A: [244959]
    automated match to d3cm8a_
    protein/RNA complex

Details for d2znla_

PDB Entry: 2znl (more details), 2.3 Å

PDB Description: Crystal structure of PA-PB1 complex form influenza virus RNA polymerase
PDB Compounds: (A:) Polymerase acidic protein

SCOPe Domain Sequences for d2znla_:

Sequence, based on SEQRES records: (download)

>d2znla_ e.77.1.1 (A:) automated matches {Influenza A virus [TaxId: 211044]}
iepflkttprplrlpngppcsqrskfllmdalklsiedpshegegiplydaikcmrtffg
wkepnvvkphekginpnyllswkqvlaelqdieneekipktknmkktsqlkwalgenmap
ekvdfddckdvgdlkqydsdepelrslaswiqnefnkaceltdsswieldeigedvapie
hiasmrrnyftsevshcrateyimkgvyintallnascaamddfqlipmiskcrtkegrr
ktnlygfiikgrshlrndtdvvnfvsmefsltdprlephkwekycvleigdmlirsaigq
vsrpmflyvrtngtskikmkwgmemrrcllqslqqiesmieaessvkekdmtkeffenks
etwpigespkgveessigkvcrtllaksvfnslyaspqlegfsaesrklllivqalrdnl
epgtfdlgglyeaieeclindpwvllnaswfnsflthals

Sequence, based on observed residues (ATOM records): (download)

>d2znla_ e.77.1.1 (A:) automated matches {Influenza A virus [TaxId: 211044]}
iepflkttprplrlpngppcsqrskfllmdalklsiedpshegegiplydaikcmrtffg
wkepnvvkphekginpnyllswkqvlaelqdiipktknmkktsqlkwalgpelrslaswi
qnefnkaceltdsswieldeigedvapiehiasmrrnyftsevshcrateyimkgvyint
allnascaamddfqlipmiskcrtkegrrktnlygfiikgrshlrndtdvvnfvsmefsl
tdprlephkwekycvleigdmlsrpmflyvrtngtskikmkwgmemrrcllqslqqiesm
ieaessvkekdmtkeffenksetwpigespkgveessigkvcrtllaksvfnslyaspql
egfsaesrklllivqalrdnlepgtfdlgglyeaieeclindpwvllnaswfnsflthal
s

SCOPe Domain Coordinates for d2znla_:

Click to download the PDB-style file with coordinates for d2znla_.
(The format of our PDB-style files is described here.)

Timeline for d2znla_: