Lineage for d1bk2__ (1bk2 -)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 227526Fold b.34: SH3-like barrel [50036] (12 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 227568Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 227569Family b.34.2.1: SH3-domain [50045] (24 proteins)
  6. 227589Protein alpha-Spectrin, SH3 domain [50058] (1 species)
  7. 227590Species Chicken (Gallus gallus) [TaxId:9031] [50059] (15 PDB entries)
  8. 227596Domain d1bk2__: 1bk2 - [24495]
    mutant

Details for d1bk2__

PDB Entry: 1bk2 (more details), 2 Å

PDB Description: a-spectrin sh3 domain d48g mutant

SCOP Domain Sequences for d1bk2__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bk2__ b.34.2.1 (-) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus)}
kelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevngrqgfvpaayvkkld

SCOP Domain Coordinates for d1bk2__:

Click to download the PDB-style file with coordinates for d1bk2__.
(The format of our PDB-style files is described here.)

Timeline for d1bk2__: