Lineage for d2zkja1 (2zkj A:20-180)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1993780Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1995156Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (2 families) (S)
    automatically mapped to Pfam PF10436
  5. 1995202Family a.29.5.0: automated matches [230678] (1 protein)
    not a true family
  6. 1995203Protein automated matches [230679] (2 species)
    not a true protein
  7. 1995204Species Human (Homo sapiens) [TaxId:9606] [230680] (8 PDB entries)
  8. 1995209Domain d2zkja1: 2zkj A:20-180 [244949]
    Other proteins in same PDB: d2zkja2, d2zkjb2
    automated match to d2bu8a1
    complexed with adp, mg, po4

Details for d2zkja1

PDB Entry: 2zkj (more details), 2 Å

PDB Description: Crystal structure of human PDK4-ADP complex
PDB Compounds: (A:) [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 4

SCOPe Domain Sequences for d2zkja1:

Sequence, based on SEQRES records: (download)

>d2zkja1 a.29.5.0 (A:20-180) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vprevehfsryspsplsmkqlldfgsenacertsfaflrqelpvrlanilkeidilptql
vntssvqlvkswyiqslmdlvefhekspddqkalsdfvdtlikvrnrhhnvvptmaqgii
eykdactvdpvtnqnlqyfldrfymnristrmlmnqhilif

Sequence, based on observed residues (ATOM records): (download)

>d2zkja1 a.29.5.0 (A:20-180) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vprevehfsryspsplsmkqlldfgscertsfaflrqelpvrlanilkeidilptqlvnt
ssvqlvkswyiqslmdlvefhekspddqkalsdfvdtlikvrnrhhnvvptmaqgiieyk
dactvdpvtnqnlqyfldrfymnristrmlmnqhilif

SCOPe Domain Coordinates for d2zkja1:

Click to download the PDB-style file with coordinates for d2zkja1.
(The format of our PDB-style files is described here.)

Timeline for d2zkja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zkja2