Lineage for d1qkwa_ (1qkw A:)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.34: SH3-like barrel [50036] (9 superfamilies) 
Superfamily b.34.2: SH3-domain [50044] (1 family) 
Family b.34.2.1: SH3-domain [50045] (20 proteins) 
Protein alpha-Spectrin, SH3 domain [50058] (1 species) Species Chicken (Gallus gallus) [TaxId:9031] [50059] (10 PDB entries) 
Domain d1qkwa_: 1qkw A: [24494]
Details for d1qkwa_
PDB Entry: 1qkw (more details), 2 Å
PDB Description: alpha-spectrin src homology 3 domain, n47g mutant in the distal loop.
SCOP Domain Sequences for d1qkwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qkwa_ b.34.2.1 (A:) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus)}
kelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevgdrqgfvpaayvkkld
SCOP Domain Coordinates for d1qkwa_:
Click to download the PDB-style file with coordinates for d1qkwa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qkwa_:
- d1qkwa_ first appeared (with stable ids) in SCOP 1.55
- d1qkwa_ appears in SCOP 1.57
- d1qkwa_ appears in SCOP 1.61
- d1qkwa_ appears in the current release, SCOPe 2.08
View in 3D