SCOPe 2.04: Domain d2zc5d_: 2zc5 D:

Lineage for d2zc5d_ (2zc5 D:)

1. Root: SCOPe 2.04

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein automated matches [190161] (19 species)
   not a true protein

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [188417] (3 PDB entries)

8. Domain d2zc5d_: 2zc5 D: [244907]
   automated match to d2c5wb1
   complexed with bmg, zn

Details for d2zc5d_

PDB Entry: 2zc5, 3 Å

PDB Description: penicillin-binding protein 1a (pbp 1a) acyl-enzyme complex (biapenem) from streptococcus pneumoniae

PDB Compounds: (D:) penicillin-binding protein 1a

SCOPe Domain Sequences for d2zc5d_:

Sequence; same for both SEQRES and ATOM records:

>d2zc5d_ e.3.1.1 (D:) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
nypaymdnylkevinqveeetgynllttgmdvytnvdqeaqkhlwdiyntdeyvaypdde
lqvastivdvsngkviaqlgarhqssnvsfginqavetnrdwgstmkpitdyapaleygv
ydstativhdepynypgtntpvynwdrgyfgnitlqyalqqsrnvpavetlnkvglnrak
tflnglgidypsihysnaissnttesdkkygassekmaaayaafanggtyykpmyihkvv
fsdgsekefsnvgtramkettaymmtdmmktvlsygtgqnaylawlpqagktgtsnytde
eienhiktsqfvapdelfagytrkysmavwtgysnrltplvgngltvaakvyrsmmtyls
egsnpedwnipeglyrngefvfkn

Timeline for d2zc5d_:

• d2zc5d_ is new in SCOPe 2.04-stable
  
• d2zc5d_ appears in SCOPe 2.05
  
• d2zc5d_ appears in the current release, SCOPe 2.08