Lineage for d1pwta_ (1pwt A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2392486Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2392487Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2392511Protein alpha-Spectrin, SH3 domain [50058] (1 species)
  7. 2392512Species Chicken (Gallus gallus) [TaxId:9031] [50059] (38 PDB entries)
  8. 2392522Domain d1pwta_: 1pwt A: [24490]
    mutant

Details for d1pwta_

PDB Entry: 1pwt (more details), 1.77 Å

PDB Description: thermodynamic analysis of alpha-spectrin sh3 and two of its circular permutants with different loop lengths: discerning the reasons for rapid folding in proteins
PDB Compounds: (A:) alpha spectrin

SCOPe Domain Sequences for d1pwta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pwta_ b.34.2.1 (A:) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]}
mgtgkelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevndrqgfvpaayvkkl
d

SCOPe Domain Coordinates for d1pwta_:

Click to download the PDB-style file with coordinates for d1pwta_.
(The format of our PDB-style files is described here.)

Timeline for d1pwta_: