Lineage for d1pwt__ (1pwt -)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 165384Fold b.34: SH3-like barrel [50036] (10 superfamilies)
  4. 165426Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 165427Family b.34.2.1: SH3-domain [50045] (23 proteins)
  6. 165446Protein alpha-Spectrin, SH3 domain [50058] (1 species)
  7. 165447Species Chicken (Gallus gallus) [TaxId:9031] [50059] (13 PDB entries)
  8. 165448Domain d1pwt__: 1pwt - [24490]

Details for d1pwt__

PDB Entry: 1pwt (more details), 1.77 Å

PDB Description: thermodynamic analysis of alpha-spectrin sh3 and two of its circular permutants with different loop lengths: discerning the reasons for rapid folding in proteins

SCOP Domain Sequences for d1pwt__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pwt__ b.34.2.1 (-) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus)}
mgtgkelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevndrqgfvpaayvkkl
d

SCOP Domain Coordinates for d1pwt__:

Click to download the PDB-style file with coordinates for d1pwt__.
(The format of our PDB-style files is described here.)

Timeline for d1pwt__: