SCOP 1.59: Domain d1pwt__: 1pwt -

Lineage for d1pwt__ (1pwt -)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.34: SH3-like barrel [50036] (9 superfamilies)

4. Superfamily b.34.2: SH3-domain [50044] (1 family)

5. Family b.34.2.1: SH3-domain [50045] (20 proteins)

6. Protein alpha-Spectrin, SH3 domain [50058] (1 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [50059] (10 PDB entries)

8. Domain d1pwt__: 1pwt - [24490]

Details for d1pwt__

PDB Entry: 1pwt, 1.77 Å

PDB Description: thermodynamic analysis of alpha-spectrin sh3 and two of its circular permutants with different loop lengths: discerning the reasons for rapid folding in proteins

SCOP Domain Sequences for d1pwt__:

Sequence; same for both SEQRES and ATOM records:

>d1pwt__ b.34.2.1 (-) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus)}
mgtgkelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevndrqgfvpaayvkkl
d

Timeline for d1pwt__:

• d1pwt__ first appeared (with stable ids) in SCOP 1.55
  
• d1pwt__ appears in SCOP 1.57
  
• d1pwt__ appears in SCOP 1.61
  
• d1pwt__ appears in the current release, SCOPe 2.08, called d1pwta_