Lineage for d1tud__ (1tud -)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58264Fold b.34: SH3-like barrel [50036] (9 superfamilies)
  4. 58293Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 58294Family b.34.2.1: SH3-domain [50045] (18 proteins)
  6. 58310Protein alpha-Spectrin, SH3 domain [50058] (1 species)
  7. 58311Species Chicken (Gallus gallus) [TaxId:9031] [50059] (9 PDB entries)
  8. 58319Domain d1tud__: 1tud - [24489]

Details for d1tud__

PDB Entry: 1tud (more details), 1.77 Å

PDB Description: alpha-spectrin src homology 3 domain, circular permutant, cut at n47- d48

SCOP Domain Sequences for d1tud__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tud__ b.34.2.1 (-) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus)}
rqgfvpaayvkkldsgtgkelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevn

SCOP Domain Coordinates for d1tud__:

Click to download the PDB-style file with coordinates for d1tud__.
(The format of our PDB-style files is described here.)

Timeline for d1tud__: