Lineage for d1g2ba_ (1g2b A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58264Fold b.34: SH3-like barrel [50036] (9 superfamilies)
  4. 58293Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 58294Family b.34.2.1: SH3-domain [50045] (18 proteins)
  6. 58310Protein alpha-Spectrin, SH3 domain [50058] (1 species)
  7. 58311Species Chicken (Gallus gallus) [TaxId:9031] [50059] (9 PDB entries)
  8. 58318Domain d1g2ba_: 1g2b A: [24488]

Details for d1g2ba_

PDB Entry: 1g2b (more details), 1.12 Å

PDB Description: alpha-spectrin src homology 3 domain, circular permutant, cut at n47- d48

SCOP Domain Sequences for d1g2ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g2ba_ b.34.2.1 (A:) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus)}
mdrqgfvpaayvkkldsgtgkelvlalydyqeksprevtmkkgdiltllnstnkdwwkve
vn

SCOP Domain Coordinates for d1g2ba_:

Click to download the PDB-style file with coordinates for d1g2ba_.
(The format of our PDB-style files is described here.)

Timeline for d1g2ba_: