Lineage for d2ywcc3 (2ywc C:383-503)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947226Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 2947245Superfamily d.52.2: GMP synthetase C-terminal dimerisation domain [54810] (2 families) (S)
    automatically mapped to Pfam PF00958
  5. 2947246Family d.52.2.1: GMP synthetase C-terminal dimerisation domain [54811] (1 protein)
  6. 2947247Protein GMP synthetase C-terminal dimerisation domain [54812] (2 species)
  7. 2947253Species Thermus thermophilus HB8 [TaxId:300852] [255717] (2 PDB entries)
  8. 2947260Domain d2ywcc3: 2ywc C:383-503 [244864]
    Other proteins in same PDB: d2ywca1, d2ywca2, d2ywcb1, d2ywcb2, d2ywcc1, d2ywcc2, d2ywcd1, d2ywcd2
    automated match to d1gpma3
    complexed with xmp

Details for d2ywcc3

PDB Entry: 2ywc (more details), 2.2 Å

PDB Description: Crystal structure of GMP synthetase from Thermus thermophilus in complex with XMP
PDB Compounds: (C:) GMP synthase [glutamine-hydrolyzing]

SCOPe Domain Sequences for d2ywcc3:

Sequence, based on SEQRES records: (download)

>d2ywcc3 d.52.2.1 (C:383-503) GMP synthetase C-terminal dimerisation domain {Thermus thermophilus HB8 [TaxId: 300852]}
gpglavrvlgevteerleilrraddiftsllrewglyekvaqalavltpvrsvgvagder
kygyvlalravttedfmtadwarlplefldeaarritrrvpeigrvvydltskppatiew
e

Sequence, based on observed residues (ATOM records): (download)

>d2ywcc3 d.52.2.1 (C:383-503) GMP synthetase C-terminal dimerisation domain {Thermus thermophilus HB8 [TaxId: 300852]}
gpglavrvlgevteerleilrraddiftsllrewglyekvaqalavltpvgyvlalravt
tedfmtadwarlplefldeaarritrrvpeigrvvydltskppatiewe

SCOPe Domain Coordinates for d2ywcc3:

Click to download the PDB-style file with coordinates for d2ywcc3.
(The format of our PDB-style files is described here.)

Timeline for d2ywcc3: