Lineage for d1pht__ (1pht -)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.34: SH3-like barrel [50036] (9 superfamilies) 
Superfamily b.34.2: SH3-domain [50044] (1 family) 
Family b.34.2.1: SH3-domain [50045] (20 proteins) 
Protein Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain [50055] (2 species) Species Human (Homo sapiens) [TaxId:9606] [50056] (3 PDB entries) 
Domain d1pht__: 1pht - [24483]
Details for d1pht__
PDB Entry: 1pht (more details), 2 Å
PDB Description: phosphatidylinositol 3-kinase p85-alpha subunit sh3 domain, residues 1-85
SCOP Domain Sequences for d1pht__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pht__ b.34.2.1 (-) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens)}
aegyqyralydykkereedidlhlgdiltvnkgslvalgfsdgqearpeeigwlngynet
tgergdfpgtyveyigrkkispp
SCOP Domain Coordinates for d1pht__:
Click to download the PDB-style file with coordinates for d1pht__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pht__:
- d1pht__ first appeared (with stable ids) in SCOP 1.55
- d1pht__ appears in SCOP 1.57
- d1pht__ appears in SCOP 1.61
- d1pht__ appears in the current release, SCOPe 2.08, called d1phta_
View in 3D