Lineage for d2ysqa1 (2ysq A:7-75)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2053714Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2054180Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2054181Protein automated matches [190457] (10 species)
    not a true protein
  7. 2054253Species Human (Homo sapiens) [TaxId:9606] [187598] (90 PDB entries)
  8. 2054374Domain d2ysqa1: 2ysq A:7-75 [244818]
    Other proteins in same PDB: d2ysqa2, d2ysqa3
    automated match to d1ue9a_

Details for d2ysqa1

PDB Entry: 2ysq (more details)

PDB Description: solution structure of the sh3 domain from rho guanine nucleotide exchange factor 9
PDB Compounds: (A:) Rho guanine nucleotide exchange factor 9

SCOPe Domain Sequences for d2ysqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ysqa1 b.34.2.0 (A:7-75) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gdsivsaeavwdhvtmanrelafkagdvikvldasnkdwwwgqiddeegwfpasfvrlwv
nqedeveeg

SCOPe Domain Coordinates for d2ysqa1:

Click to download the PDB-style file with coordinates for d2ysqa1.
(The format of our PDB-style files is described here.)

Timeline for d2ysqa1: