Lineage for d2ys7a2 (2ys7 A:102-322)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1928430Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 1928431Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) (S)
  5. 1928777Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 1928778Protein automated matches [226904] (27 species)
    not a true protein
  7. 1928818Species Geobacillus kaustophilus [TaxId:1462] [255710] (4 PDB entries)
  8. 1928820Domain d2ys7a2: 2ys7 A:102-322 [244816]
    Other proteins in same PDB: d2ys7a1, d2ys7a3
    automated match to d1gsoa3

Details for d2ys7a2

PDB Entry: 2ys7 (more details), 2.21 Å

PDB Description: Crystal structure of GAR synthetase from Geobacillus kaustophilus
PDB Compounds: (A:) Phosphoribosylglycinamide synthetase

SCOPe Domain Sequences for d2ys7a2:

Sequence, based on SEQRES records: (download)

>d2ys7a2 d.142.1.0 (A:102-322) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
skafakelmkkygiptadhaaftsyeeakayieqkgapivikadglaagkgvtvaqtvee
alaaakaalvdgqfgtagsqvvieeylegeefsfmafvngekvyplaiaqdhkraydgde
gpntggmgayspvpqisdemmdaaleailrpaakalaaegrpflgvlyaglmatangpkv
iefnarfgdpeaqvvlprlktdlveavlavmdgkelelewt

Sequence, based on observed residues (ATOM records): (download)

>d2ys7a2 d.142.1.0 (A:102-322) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
skafakelmkkygiptadhaaftsyeeakayieqkgapivikadgvtvaqtveealaaak
aalvdgqfgtagsqvvieeylegeefsfmafvngekvyplaiaqdhkraydgdegpntgg
mgayspvpqisdemmdaaleailrpaakalaaegrpflgvlyaglmatangpkviefnar
fgdpeaqvvlprlktdlveavlavmdgkelelewt

SCOPe Domain Coordinates for d2ys7a2:

Click to download the PDB-style file with coordinates for d2ys7a2.
(The format of our PDB-style files is described here.)

Timeline for d2ys7a2: