Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) |
Family d.142.1.0: automated matches [227184] (1 protein) not a true family |
Protein automated matches [226904] (27 species) not a true protein |
Species Geobacillus kaustophilus [TaxId:1462] [255710] (4 PDB entries) |
Domain d2ys7a2: 2ys7 A:102-322 [244816] Other proteins in same PDB: d2ys7a1, d2ys7a3 automated match to d1gsoa3 |
PDB Entry: 2ys7 (more details), 2.21 Å
SCOPe Domain Sequences for d2ys7a2:
Sequence, based on SEQRES records: (download)
>d2ys7a2 d.142.1.0 (A:102-322) automated matches {Geobacillus kaustophilus [TaxId: 1462]} skafakelmkkygiptadhaaftsyeeakayieqkgapivikadglaagkgvtvaqtvee alaaakaalvdgqfgtagsqvvieeylegeefsfmafvngekvyplaiaqdhkraydgde gpntggmgayspvpqisdemmdaaleailrpaakalaaegrpflgvlyaglmatangpkv iefnarfgdpeaqvvlprlktdlveavlavmdgkelelewt
>d2ys7a2 d.142.1.0 (A:102-322) automated matches {Geobacillus kaustophilus [TaxId: 1462]} skafakelmkkygiptadhaaftsyeeakayieqkgapivikadgvtvaqtveealaaak aalvdgqfgtagsqvvieeylegeefsfmafvngekvyplaiaqdhkraydgdegpntgg mgayspvpqisdemmdaaleailrpaakalaaegrpflgvlyaglmatangpkviefnar fgdpeaqvvlprlktdlveavlavmdgkelelewt
Timeline for d2ys7a2: