Lineage for d2ys6a3 (2ys6 A:323-418)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1808932Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 1809035Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) (S)
  5. 1809160Family b.84.2.0: automated matches [254217] (1 protein)
    not a true family
  6. 1809161Protein automated matches [254496] (11 species)
    not a true protein
  7. 1809179Species Geobacillus kaustophilus [TaxId:1462] [255711] (4 PDB entries)
  8. 1809183Domain d2ys6a3: 2ys6 A:323-418 [244814]
    Other proteins in same PDB: d2ys6a1, d2ys6a2
    automated match to d1gsoa1
    complexed with amp, gly

Details for d2ys6a3

PDB Entry: 2ys6 (more details), 2.21 Å

PDB Description: Crystal structure of GAR synthetase from Geobacillus kaustophilus
PDB Compounds: (A:) Phosphoribosylglycinamide synthetase

SCOPe Domain Sequences for d2ys6a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ys6a3 b.84.2.0 (A:323-418) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
deavlgvvlaakgypgayergaeirgldrispdallfhagtkreggawytnggrvlllaa
kgetlakakekayeqlaaidcdglfyrrdigrraie

SCOPe Domain Coordinates for d2ys6a3:

Click to download the PDB-style file with coordinates for d2ys6a3.
(The format of our PDB-style files is described here.)

Timeline for d2ys6a3: