Lineage for d2yrxa3 (2yrx A:323-417)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1560127Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 1560230Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) (S)
  5. 1560355Family b.84.2.0: automated matches [254217] (1 protein)
    not a true family
  6. 1560356Protein automated matches [254496] (10 species)
    not a true protein
  7. 1560374Species Geobacillus kaustophilus [TaxId:1462] [255711] (4 PDB entries)
  8. 1560375Domain d2yrxa3: 2yrx A:323-417 [244808]
    Other proteins in same PDB: d2yrxa1, d2yrxa2
    automated match to d1gsoa1
    complexed with amp, po4

Details for d2yrxa3

PDB Entry: 2yrx (more details), 1.9 Å

PDB Description: Crystal structure of GAR synthetase from Geobacillus kaustophilus
PDB Compounds: (A:) Phosphoribosylglycinamide synthetase

SCOPe Domain Sequences for d2yrxa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yrxa3 b.84.2.0 (A:323-417) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
deavlgvvlaakgypgayergaeirgldrispdallfhagtkreggawytnggrvlllaa
kgetlakakekayeqlaaidcdglfyrrdigrrai

SCOPe Domain Coordinates for d2yrxa3:

Click to download the PDB-style file with coordinates for d2yrxa3.
(The format of our PDB-style files is described here.)

Timeline for d2yrxa3: