Class b: All beta proteins [48724] (176 folds) |
Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) |
Family b.84.2.0: automated matches [254217] (1 protein) not a true family |
Protein automated matches [254496] (10 species) not a true protein |
Species Geobacillus kaustophilus [TaxId:1462] [255711] (4 PDB entries) |
Domain d2yrxa3: 2yrx A:323-417 [244808] Other proteins in same PDB: d2yrxa1, d2yrxa2 automated match to d1gsoa1 complexed with amp, po4 |
PDB Entry: 2yrx (more details), 1.9 Å
SCOPe Domain Sequences for d2yrxa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yrxa3 b.84.2.0 (A:323-417) automated matches {Geobacillus kaustophilus [TaxId: 1462]} deavlgvvlaakgypgayergaeirgldrispdallfhagtkreggawytnggrvlllaa kgetlakakekayeqlaaidcdglfyrrdigrrai
Timeline for d2yrxa3: