Lineage for d2yrxa2 (2yrx A:102-322)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671104Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 1671105Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) (S)
  5. 1671442Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 1671443Protein automated matches [226904] (25 species)
    not a true protein
  7. 1671483Species Geobacillus kaustophilus [TaxId:1462] [255710] (4 PDB entries)
  8. 1671484Domain d2yrxa2: 2yrx A:102-322 [244807]
    Other proteins in same PDB: d2yrxa1, d2yrxa3
    automated match to d1gsoa3
    complexed with amp, po4

Details for d2yrxa2

PDB Entry: 2yrx (more details), 1.9 Å

PDB Description: Crystal structure of GAR synthetase from Geobacillus kaustophilus
PDB Compounds: (A:) Phosphoribosylglycinamide synthetase

SCOPe Domain Sequences for d2yrxa2:

Sequence, based on SEQRES records: (download)

>d2yrxa2 d.142.1.0 (A:102-322) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
skafakelmkkygiptadhaaftsyeeakayieqkgapivikadglaagkgvtvaqtvee
alaaakaalvdgqfgtagsqvvieeylegeefsfmafvngekvyplaiaqdhkraydgde
gpntggmgayspvpqisdemmdaaleailrpaakalaaegrpflgvlyaglmatangpkv
iefnarfgdpeaqvvlprlktdlveavlavmdgkelelewt

Sequence, based on observed residues (ATOM records): (download)

>d2yrxa2 d.142.1.0 (A:102-322) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
skafakelmkkygiptadhaaftsyeeakayieqkgapivikadgkgvtvaqtveealaa
akaalvdgqfgtagsqvvieeylegeefsfmafvngekvyplaiaqdhkraydgdegpnt
ggmgayspvpqisdemmdaaleailrpaakalaaegrpflgvlyaglmatangpkviefn
arfgdpeaqvvlprlktdlveavlavmdgkelelewt

SCOPe Domain Coordinates for d2yrxa2:

Click to download the PDB-style file with coordinates for d2yrxa2.
(The format of our PDB-style files is described here.)

Timeline for d2yrxa2: