SCOPe 2.04: Domain d2yrxa1: 2yrx A:-7-101

Lineage for d2yrxa1 (2yrx A:-7-101)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (9 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.0: automated matches [227183] (1 protein)
   not a true family

6. Protein automated matches [226903] (25 species)
   not a true protein

7. Species Geobacillus kaustophilus [TaxId:1462] [255709] (4 PDB entries)

8. Domain d2yrxa1: 2yrx A:-7-101 [244806]
   Other proteins in same PDB: d2yrxa2, d2yrxa3
   automated match to d1gsoa2
   complexed with amp, po4

Details for d2yrxa1

PDB Entry: 2yrx, 1.9 Å

PDB Description: Crystal structure of GAR synthetase from Geobacillus kaustophilus

PDB Compounds: (A:) Phosphoribosylglycinamide synthetase

SCOPe Domain Sequences for d2yrxa1:

Sequence; same for both SEQRES and ATOM records:

>d2yrxa1 c.30.1.0 (A:-7-101) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
nlyfqshmnvlvigrggrehaiawkaaqsplvgklyvapgnpgiadvaelvhideldiea
lvqfakqqaidltivgpeaplasgivdrfmaeglrifgpsqraalieg

Timeline for d2yrxa1:

• d2yrxa1 is new in SCOPe 2.04-stable
  
• d2yrxa1 appears in SCOPe 2.05
  
• d2yrxa1 appears in the current release, SCOPe 2.08