SCOPe 2.06: Domain d2yrwa3: 2yrw A:323-418

Lineage for d2yrwa3 (2yrw A:323-418)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families)

5. Family b.84.2.0: automated matches [254217] (1 protein)
   not a true family

6. Protein automated matches [254496] (13 species)
   not a true protein

7. Species Geobacillus kaustophilus [TaxId:1462] [255711] (4 PDB entries)

8. Domain d2yrwa3: 2yrw A:323-418 [244805]
   Other proteins in same PDB: d2yrwa1, d2yrwa2, d2yrwa4
   automated match to d1gsoa1
   complexed with po4

Details for d2yrwa3

PDB Entry: 2yrw, 2.2 Å

PDB Description: Crystal structure of GAR synthetase from Geobacillus kaustophilus

PDB Compounds: (A:) Phosphoribosylglycinamide synthetase

SCOPe Domain Sequences for d2yrwa3:

Sequence; same for both SEQRES and ATOM records:

>d2yrwa3 b.84.2.0 (A:323-418) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
deavlgvvlaakgypgayergaeirgldrispdallfhagtkreggawytnggrvlllaa
kgetlakakekayeqlaaidcdglfyrrdigrraie

Timeline for d2yrwa3:

• d2yrwa3 first appeared in SCOPe 2.04
  
• d2yrwa3 appears in SCOPe 2.05
  
• d2yrwa3 appears in SCOPe 2.07
  
• d2yrwa3 appears in the current release, SCOPe 2.08