Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
Family c.30.1.0: automated matches [227183] (1 protein) not a true family |
Protein automated matches [226903] (35 species) not a true protein |
Species Geobacillus kaustophilus [TaxId:1462] [255709] (4 PDB entries) |
Domain d2yrwa1: 2yrw A:1-101 [244803] Other proteins in same PDB: d2yrwa2, d2yrwa3, d2yrwa4 automated match to d1gsoa2 complexed with po4 |
PDB Entry: 2yrw (more details), 2.2 Å
SCOPe Domain Sequences for d2yrwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yrwa1 c.30.1.0 (A:1-101) automated matches {Geobacillus kaustophilus [TaxId: 1462]} mnvlvigrggrehaiawkaaqsplvgklyvapgnpgiadvaelvhideldiealvqfakq qaidltivgpeaplasgivdrfmaeglrifgpsqraalieg
Timeline for d2yrwa1: