Lineage for d2yroa_ (2yro A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1781809Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 1781810Protein automated matches [190437] (37 species)
    not a true protein
  7. 1781960Species Human (Homo sapiens) [TaxId:9606] [187655] (48 PDB entries)
  8. 1782069Domain d2yroa_: 2yro A: [244802]
    automated match to d3nv1a_

Details for d2yroa_

PDB Entry: 2yro (more details)

PDB Description: solution structure of the c-terminal gal-bind lectin protein from human galectin-8
PDB Compounds: (A:) Galectin-8

SCOPe Domain Sequences for d2yroa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yroa_ b.29.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgpksgtpqlslpfaarlntpmgpgrtvvvkgevnanaksfnvdllagkskdial
hlnprlnikafvrnsflqeswgeeernitsfpfspgmyfemiiycdvrefkvavngvhsl
eykhrfkelssidtleingdihllevrswsgpssg

SCOPe Domain Coordinates for d2yroa_:

Click to download the PDB-style file with coordinates for d2yroa_.
(The format of our PDB-style files is described here.)

Timeline for d2yroa_: