SCOP 1.63: Domain d1bbzg_: 1bbz G:

Lineage for d1bbzg_ (1bbz G:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.34: SH3-like barrel [50036] (12 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (1 family)

5. Family b.34.2.1: SH3-domain [50045] (24 proteins)

6. Protein Abl tyrosine kinase, SH3 domain [50052] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50054] (4 PDB entries)

8. Domain d1bbzg_: 1bbz G: [24480]
   complexed with ace, so4

Details for d1bbzg_

PDB Entry: 1bbz, 1.65 Å

PDB Description: crystal structure of the abl-sh3 domain complexed with a designed high-affinity peptide ligand: implications for sh3-ligand interactions

SCOP Domain Sequences for d1bbzg_:

Sequence; same for both SEQRES and ATOM records:

>d1bbzg_ b.34.2.1 (G:) Abl tyrosine kinase, SH3 domain {Human (Homo sapiens)}
nlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpvns

Timeline for d1bbzg_:

• d1bbzg_ first appeared (with stable ids) in SCOP 1.55
  
• d1bbzg_ appears in SCOP 1.61
  
• d1bbzg_ appears in SCOP 1.65
  
• d1bbzg_ appears in the current release, SCOPe 2.08