Lineage for d1bbzg_ (1bbz G:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 109314Fold b.34: SH3-like barrel [50036] (9 superfamilies)
  4. 109356Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 109357Family b.34.2.1: SH3-domain [50045] (20 proteins)
  6. 109361Protein Abl tyrosine kinase, SH3 domain [50052] (2 species)
  7. 109362Species Human (Homo sapiens) [TaxId:9606] [50054] (3 PDB entries)
  8. 109366Domain d1bbzg_: 1bbz G: [24480]

Details for d1bbzg_

PDB Entry: 1bbz (more details), 1.65 Å

PDB Description: crystal structure of the abl-sh3 domain complexed with a designed high-affinity peptide ligand: implications for sh3-ligand interactions

SCOP Domain Sequences for d1bbzg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bbzg_ b.34.2.1 (G:) Abl tyrosine kinase, SH3 domain {Human (Homo sapiens)}
nlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpvns

SCOP Domain Coordinates for d1bbzg_:

Click to download the PDB-style file with coordinates for d1bbzg_.
(The format of our PDB-style files is described here.)

Timeline for d1bbzg_: