SCOPe 2.06: Domain d1bbze_: 1bbz E:

Lineage for d1bbze_ (1bbz E:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein Abl tyrosine kinase, SH3 domain [50052] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50054] (6 PDB entries)

8. Domain d1bbze_: 1bbz E: [24479]
   complexed with so4

Details for d1bbze_

PDB Entry: 1bbz, 1.65 Å

PDB Description: crystal structure of the abl-sh3 domain complexed with a designed high-affinity peptide ligand: implications for sh3-ligand interactions

PDB Compounds: (E:) abl tyrosine kinase

SCOPe Domain Sequences for d1bbze_:

Sequence; same for both SEQRES and ATOM records:

>d1bbze_ b.34.2.1 (E:) Abl tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]}
nlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpvns

Timeline for d1bbze_:

• d1bbze_ first appeared (with stable ids) in SCOP 1.55
  
• d1bbze_ appears in SCOPe 2.05
  
• d1bbze_ appears in SCOPe 2.07
  
• d1bbze_ appears in the current release, SCOPe 2.08