SCOP 1.61: Domain d1bbzc_: 1bbz C:

Lineage for d1bbzc_ (1bbz C:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.34: SH3-like barrel [50036] (10 superfamilies)

4. Superfamily b.34.2: SH3-domain [50044] (1 family)

5. Family b.34.2.1: SH3-domain [50045] (23 proteins)

6. Protein Abl tyrosine kinase, SH3 domain [50052] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50054] (3 PDB entries)

8. Domain d1bbzc_: 1bbz C: [24478]

Details for d1bbzc_

PDB Entry: 1bbz, 1.65 Å

PDB Description: crystal structure of the abl-sh3 domain complexed with a designed high-affinity peptide ligand: implications for sh3-ligand interactions

SCOP Domain Sequences for d1bbzc_:

Sequence; same for both SEQRES and ATOM records:

>d1bbzc_ b.34.2.1 (C:) Abl tyrosine kinase, SH3 domain {Human (Homo sapiens)}
nlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpvns

Timeline for d1bbzc_:

• d1bbzc_ first appeared (with stable ids) in SCOP 1.55
  
• d1bbzc_ appears in SCOP 1.59
  
• d1bbzc_ appears in SCOP 1.63
  
• d1bbzc_ appears in the current release, SCOPe 2.08