Lineage for d1bbza_ (1bbz A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13047Fold b.34: SH3-like barrel [50036] (7 superfamilies)
  4. 13067Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 13068Family b.34.2.1: SH3-domain [50045] (16 proteins)
  6. 13072Protein Abl tyrosine kinase, SH3 domain [50052] (2 species)
  7. 13073Species Human (Homo sapiens) [TaxId:9606] [50054] (3 PDB entries)
  8. 13074Domain d1bbza_: 1bbz A: [24477]

Details for d1bbza_

PDB Entry: 1bbz (more details), 1.65 Å

PDB Description: crystal structure of the abl-sh3 domain complexed with a designed high-affinity peptide ligand: implications for sh3-ligand interactions

SCOP Domain Sequences for d1bbza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bbza_ b.34.2.1 (A:) Abl tyrosine kinase, SH3 domain {Human (Homo sapiens)}
nlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpvns

SCOP Domain Coordinates for d1bbza_:

Click to download the PDB-style file with coordinates for d1bbza_.
(The format of our PDB-style files is described here.)

Timeline for d1bbza_: