SCOPe 2.06: Domain d1abob_: 1abo B:

Lineage for d1abob_ (1abo B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein Abl tyrosine kinase, SH3 domain [50052] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [50053] (3 PDB entries)

8. Domain d1abob_: 1abo B: [24475]
   complexed with so4

Details for d1abob_

PDB Entry: 1abo, 2 Å

PDB Description: crystal structure of the complex of the abl tyrosine kinase sh3 domain with 3bp-1 synthetic peptide

PDB Compounds: (B:) abl tyrosine kinase

SCOPe Domain Sequences for d1abob_:

Sequence; same for both SEQRES and ATOM records:

>d1abob_ b.34.2.1 (B:) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]}
nlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpvns

Timeline for d1abob_:

• d1abob_ first appeared (with stable ids) in SCOP 1.55
  
• d1abob_ appears in SCOPe 2.05
  
• d1abob_ appears in SCOPe 2.07
  
• d1abob_ appears in the current release, SCOPe 2.08