SCOPe 2.05: Domain d2yd5a2: 2yd5 A:125-228

Lineage for d2yd5a2 (2yd5 A:125-228)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)

8. Domain d2yd5a2: 2yd5 A:125-228 [244735]
   automated match to d2v9ta_

Details for d2yd5a2

PDB Entry: 2yd5, 2.2 Å

PDB Description: crystal structure of the n-terminal ig1-2 module of human receptor protein tyrosine phosphatase lar

PDB Compounds: (A:) Receptor-type tyrosine-protein phosphatase F

SCOPe Domain Sequences for d2yd5a2:

Sequence; same for both SEQRES and ATOM records:

>d2yd5a2 b.1.1.0 (A:125-228) automated matches {Human (Homo sapiens) [TaxId: 9606]}
leeeqlppgfpsidmgpqlkvvekartatmlcaaggnpdpeiswfkdflpvdpatsngri
kqlrsgalqiesseesdqgkyecvatnsagtrysapanlyvrvr

Timeline for d2yd5a2:

• d2yd5a2 first appeared in SCOPe 2.04
  
• d2yd5a2 appears in SCOPe 2.06
  
• d2yd5a2 appears in the current release, SCOPe 2.08