Lineage for d2yd0a1 (2yd0 A:46-254)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2820567Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
    duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain
  4. 2820568Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) (S)
  5. 2820569Family b.98.1.1: Zn aminopeptidase N-terminal domain [63738] (4 proteins)
  6. 2820581Protein ERAP1 N-terminal domain [254380] (1 species)
  7. 2820582Species Human (Homo sapiens) [TaxId:9606] [254813] (2 PDB entries)
  8. 2820584Domain d2yd0a1: 2yd0 A:46-254 [244726]
    Other proteins in same PDB: d2yd0a2, d2yd0a3, d2yd0a4
    complexed with bes, edo, k, nag, zn

Details for d2yd0a1

PDB Entry: 2yd0 (more details), 2.7 Å

PDB Description: crystal structure of the soluble domain of human endoplasmic reticulum aminopeptidase 1 erap1
PDB Compounds: (A:) endoplasmic reticulum aminopeptidase 1

SCOPe Domain Sequences for d2yd0a1:

Sequence, based on SEQRES records: (download)

>d2yd0a1 b.98.1.1 (A:46-254) ERAP1 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
pfpwnkirlpeyvipvhydllihanlttltfwgttkveitasqptstiilhshhlqisra
tlrkgagerlseeplqvlehprqeqiallapepllvglpytvvihyagnlsetfhgfyks
tyrtkegelrilastqfeptaarmafpcfdepafkasfsikirreprhlaisnmplvksv
tvaegliedhfdvtvkmstylvafiisdf

Sequence, based on observed residues (ATOM records): (download)

>d2yd0a1 b.98.1.1 (A:46-254) ERAP1 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
pfpwnkirlpeyvipvhydllihanlttltfwgttkveitasqptstiilhshhlqisra
tlrkglseeplqvlehprqeqiallapepllvglpytvvihyagnlsetfhgfykstyrt
kegelrilastqfeptaarmafpcfdepafkasfsikirreprhlaisnmplvksvtvae
gliedhfdvtvkmstylvafiisdf

SCOPe Domain Coordinates for d2yd0a1:

Click to download the PDB-style file with coordinates for d2yd0a1.
(The format of our PDB-style files is described here.)

Timeline for d2yd0a1: