SCOPe 2.04: Domain d2xy1a2: 2xy1 A:301-398

Lineage for d2xy1a2 (2xy1 A:301-398)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)

8. Domain d2xy1a2: 2xy1 A:301-398 [244619]
   automated match to d3kvqa_
   complexed with nag

Details for d2xy1a2

PDB Entry: 2xy1, 1.98 Å

PDB Description: crystal structure of ncam2 ig3-4

PDB Compounds: (A:) Neural cell adhesion molecule 2

SCOPe Domain Sequences for d2xy1a2:

Sequence; same for both SEQRES and ATOM records:

>d2xy1a2 b.1.1.0 (A:301-398) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qphiiqlknettyengqvtlvcdaegepipeitwkravdgftftegdksldgrievkgqh
gssslhikdvklsdsgrydceaasrigghqksmyldie

Timeline for d2xy1a2:

• d2xy1a2 is new in SCOPe 2.04-stable
  
• d2xy1a2 appears in SCOPe 2.05
  
• d2xy1a2 appears in the current release, SCOPe 2.08