| Class a: All alpha proteins [46456] (285 folds) |
| Fold a.246: Hyaluronidase domain-like [140656] (3 superfamilies) 5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology |
Superfamily a.246.1: Hyaluronidase post-catalytic domain-like [140657] (2 families) ![]() |
| Family a.246.1.0: automated matches [254242] (1 protein) not a true family |
| Protein automated matches [254554] (2 species) not a true protein |
| Species Clostridium perfringens [TaxId:1502] [255691] (1 PDB entry) |
| Domain d2xpkb3: 2xpk B:496-624 [244581] Other proteins in same PDB: d2xpka1, d2xpka2, d2xpkb1, d2xpkb2 automated match to d2v5ca3 complexed with z0m |
PDB Entry: 2xpk (more details), 2.4 Å
SCOPe Domain Sequences for d2xpkb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xpkb3 a.246.1.0 (B:496-624) automated matches {Clostridium perfringens [TaxId: 1502]}
edapelrakmdelwnklsskedasalieelygefarmeeacnnlkanlpevaleecsrql
delitlaqgdkasldmivaqlnedteayesakeiaqnklntalssfavisekvaqsfiqe
alsfdltli
Timeline for d2xpkb3: