SCOPe 2.07: Domain d2xpkb2: 2xpk B:179-495

Lineage for d2xpkb2 (2xpk B:179-495)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.10: alpha-D-glucuronidase/Hyaluronidase catalytic domain [82253] (4 proteins)
   Glycosyl hydrolase family 67, GH67; structurally related to GH20; contains extra C-terminal alpha-helical subdomain

6. Protein automated matches [254553] (3 species)
   not a true protein

7. Species Clostridium perfringens [TaxId:1502] [255690] (2 PDB entries)

8. Domain d2xpkb2: 2xpk B:179-495 [244580]
   Other proteins in same PDB: d2xpka1, d2xpka3, d2xpkb1, d2xpkb3
   automated match to d2v5ca2
   complexed with z0m

Details for d2xpkb2

PDB Entry: 2xpk, 2.4 Å

PDB Description: cell-penetrant, nanomolar o-glcnacase inhibitors selective against lysosomal hexosaminidases

PDB Compounds: (B:) O-GlcNAcase nagJ

SCOPe Domain Sequences for d2xpkb2:

Sequence; same for both SEQRES and ATOM records:

>d2xpkb2 c.1.8.10 (B:179-495) automated matches {Clostridium perfringens [TaxId: 1502]}
vsargivegfygtpwthqdrldqikfygenklntyiyapkddpyhrekwrepypesemqr
mqelinasaenkvdfvfgispgidirfdgdageedfnhlitkaeslydmgvrsfaiywdd
iqdksaakhaqvlnrfneefvkakgdvkplitcpteydtgamvsngqpraytrifaetvd
psievmwtgpgvvtneiplsdaqlisgiydrnmavwwnypvtdyfkgklalgpmhgldkg
lnqyvdfftvnpmehaelskisihtaadyswnmdnydydkawnraidmlygdlaedmkvf
anhstrmdnktwaksgr

Timeline for d2xpkb2:

• d2xpkb2 first appeared in SCOPe 2.04
  
• d2xpkb2 appears in SCOPe 2.06
  
• d2xpkb2 appears in the current release, SCOPe 2.08