SCOPe 2.07: Domain d2xpka3: 2xpk A:496-624

Lineage for d2xpka3 (2xpk A:496-624)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.246: Hyaluronidase domain-like [140656] (3 superfamilies)
   5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology

4. Superfamily a.246.1: Hyaluronidase post-catalytic domain-like [140657] (2 families)

5. Family a.246.1.0: automated matches [254242] (1 protein)
   not a true family

6. Protein automated matches [254554] (3 species)
   not a true protein

7. Species Clostridium perfringens [TaxId:1502] [255691] (3 PDB entries)

8. Domain d2xpka3: 2xpk A:496-624 [244578]
   Other proteins in same PDB: d2xpka1, d2xpka2, d2xpkb1, d2xpkb2
   automated match to d2v5ca3
   complexed with z0m

Details for d2xpka3

PDB Entry: 2xpk, 2.4 Å

PDB Description: cell-penetrant, nanomolar o-glcnacase inhibitors selective against lysosomal hexosaminidases

PDB Compounds: (A:) O-GlcNAcase nagJ

SCOPe Domain Sequences for d2xpka3:

Sequence; same for both SEQRES and ATOM records:

>d2xpka3 a.246.1.0 (A:496-624) automated matches {Clostridium perfringens [TaxId: 1502]}
edapelrakmdelwnklsskedasalieelygefarmeeacnnlkanlpevaleecsrql
delitlaqgdkasldmivaqlnedteayesakeiaqnklntalssfavisekvaqsfiqe
alsfdltli

Timeline for d2xpka3:

• d2xpka3 first appeared in SCOPe 2.04
  
• d2xpka3 appears in SCOPe 2.06
  
• d2xpka3 appears in the current release, SCOPe 2.08