Lineage for d2xpka1 (2xpk A:40-178)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2570195Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2571709Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) (S)
    contains similar fold but lacks its catalytic centre
  5. 2571811Family d.92.2.0: automated matches [227269] (1 protein)
    not a true family
  6. 2571812Protein automated matches [227062] (5 species)
    not a true protein
  7. 2571819Species Clostridium perfringens [TaxId:1502] [255689] (3 PDB entries)
  8. 2571820Domain d2xpka1: 2xpk A:40-178 [244576]
    Other proteins in same PDB: d2xpka2, d2xpka3, d2xpkb2, d2xpkb3
    automated match to d2v5ca1
    complexed with z0m

Details for d2xpka1

PDB Entry: 2xpk (more details), 2.4 Å

PDB Description: cell-penetrant, nanomolar o-glcnacase inhibitors selective against lysosomal hexosaminidases
PDB Compounds: (A:) O-GlcNAcase nagJ

SCOPe Domain Sequences for d2xpka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xpka1 d.92.2.0 (A:40-178) automated matches {Clostridium perfringens [TaxId: 1502]}
qvlvpnlnptpenlevvgdgfkitssinlvgeeeadenavnalrefltannieinsendp
nsttliigevdddipeldealngttaenlkeegyalvsndgkiaiegkdgdgtfygvqtf
kqlvkesnipevnitdypt

SCOPe Domain Coordinates for d2xpka1:

Click to download the PDB-style file with coordinates for d2xpka1.
(The format of our PDB-style files is described here.)

Timeline for d2xpka1: