SCOPe 2.06: Domain d2xpka1: 2xpk A:40-178

Lineage for d2xpka1 (2xpk A:40-178)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families)
   contains similar fold but lacks its catalytic centre

5. Family d.92.2.0: automated matches [227269] (1 protein)
   not a true family

6. Protein automated matches [227062] (4 species)
   not a true protein

7. Species Clostridium perfringens [TaxId:1502] [255689] (1 PDB entry)

8. Domain d2xpka1: 2xpk A:40-178 [244576]
   Other proteins in same PDB: d2xpka2, d2xpka3, d2xpkb2, d2xpkb3
   automated match to d2v5ca1
   complexed with z0m

Details for d2xpka1

PDB Entry: 2xpk, 2.4 Å

PDB Description: cell-penetrant, nanomolar o-glcnacase inhibitors selective against lysosomal hexosaminidases

PDB Compounds: (A:) O-GlcNAcase nagJ

SCOPe Domain Sequences for d2xpka1:

Sequence; same for both SEQRES and ATOM records:

>d2xpka1 d.92.2.0 (A:40-178) automated matches {Clostridium perfringens [TaxId: 1502]}
qvlvpnlnptpenlevvgdgfkitssinlvgeeeadenavnalrefltannieinsendp
nsttliigevdddipeldealngttaenlkeegyalvsndgkiaiegkdgdgtfygvqtf
kqlvkesnipevnitdypt

Timeline for d2xpka1:

• d2xpka1 first appeared in SCOPe 2.04
  
• d2xpka1 appears in SCOPe 2.05
  
• d2xpka1 appears in SCOPe 2.07
  
• d2xpka1 appears in the current release, SCOPe 2.08