Lineage for d2xokf1 (2xok F:7-82)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1795771Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 1795772Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (2 families) (S)
    automatically mapped to Pfam PF02874
  5. 1795900Family b.49.1.0: automated matches [254232] (1 protein)
    not a true family
  6. 1795901Protein automated matches [254527] (7 species)
    not a true protein
  7. 1795909Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255212] (6 PDB entries)
  8. 1795954Domain d2xokf1: 2xok F:7-82 [244561]
    Other proteins in same PDB: d2xokd2, d2xokd3, d2xoke2, d2xoke3, d2xokf2, d2xokf3, d2xokg_
    automated match to d2jdid2
    complexed with anp, mg

Details for d2xokf1

PDB Entry: 2xok (more details), 3.01 Å

PDB Description: refined structure of yeast f1c10 atpase complex to 3 a resolution
PDB Compounds: (F:) ATP synthase subunit beta, mitochondrial

SCOPe Domain Sequences for d2xokf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xokf1 b.49.1.0 (F:7-82) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamdg
teglvrgekvldtggp

SCOPe Domain Coordinates for d2xokf1:

Click to download the PDB-style file with coordinates for d2xokf1.
(The format of our PDB-style files is described here.)

Timeline for d2xokf1: