![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies) barrel, closed; n=6, S=8; greek-key |
![]() | Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (2 families) ![]() automatically mapped to Pfam PF02874 |
![]() | Family b.49.1.0: automated matches [254232] (1 protein) not a true family |
![]() | Protein automated matches [254527] (6 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255212] (6 PDB entries) |
![]() | Domain d2xokf1: 2xok F:7-82 [244561] Other proteins in same PDB: d2xokd2, d2xokd3, d2xoke2, d2xoke3, d2xokf2, d2xokf3, d2xokg_ automated match to d2jdid2 complexed with anp, mg |
PDB Entry: 2xok (more details), 3.01 Å
SCOPe Domain Sequences for d2xokf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xokf1 b.49.1.0 (F:7-82) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} tpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamdg teglvrgekvldtggp
Timeline for d2xokf1: