SCOPe 2.04: Domain d2xokf1: 2xok F:7-82

Lineage for d2xokf1 (2xok F:7-82)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (2 families)
   automatically mapped to Pfam PF02874

5. Family b.49.1.0: automated matches [254232] (1 protein)
   not a true family

6. Protein automated matches [254527] (6 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255212] (6 PDB entries)

8. Domain d2xokf1: 2xok F:7-82 [244561]
   Other proteins in same PDB: d2xokd2, d2xokd3, d2xoke2, d2xoke3, d2xokf2, d2xokf3, d2xokg_
   automated match to d2jdid2
   complexed with anp, mg

Details for d2xokf1

PDB Entry: 2xok, 3.01 Å

PDB Description: refined structure of yeast f1c10 atpase complex to 3 a resolution

PDB Compounds: (F:) ATP synthase subunit beta, mitochondrial

SCOPe Domain Sequences for d2xokf1:

Sequence; same for both SEQRES and ATOM records:

>d2xokf1 b.49.1.0 (F:7-82) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamdg
teglvrgekvldtggp

Timeline for d2xokf1:

• d2xokf1 is new in SCOPe 2.04-stable
  
• d2xokf1 appears in SCOPe 2.05
  
• d2xokf1 appears in the current release, SCOPe 2.08