SCOPe 2.04: Domain d2xoke3: 2xok E:358-476

Lineage for d2xoke3 (2xok E:358-476)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (2 families)

5. Family a.69.1.0: automated matches [254233] (1 protein)
   not a true family

6. Protein automated matches [254528] (6 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255214] (6 PDB entries)

8. Domain d2xoke3: 2xok E:358-476 [244560]
   Other proteins in same PDB: d2xokd1, d2xokd2, d2xoke1, d2xoke2, d2xokf1, d2xokf2, d2xokg_
   automated match to d2jdid1
   complexed with anp, mg

Details for d2xoke3

PDB Entry: 2xok, 3.01 Å

PDB Description: refined structure of yeast f1c10 atpase complex to 3 a resolution

PDB Compounds: (E:) ATP synthase subunit beta, mitochondrial

SCOPe Domain Sequences for d2xoke3:

Sequence; same for both SEQRES and ATOM records:

>d2xoke3 a.69.1.0 (E:358-476) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ldaavvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqp
favaevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaae

Timeline for d2xoke3:

• d2xoke3 is new in SCOPe 2.04-stable
  
• d2xoke3 appears in SCOPe 2.05
  
• d2xoke3 appears in the current release, SCOPe 2.08