Class a: All alpha proteins [46456] (285 folds) |
Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (2 families) |
Family a.69.1.0: automated matches [254233] (1 protein) not a true family |
Protein automated matches [254528] (6 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255214] (6 PDB entries) |
Domain d2xokd3: 2xok D:358-476 [244557] Other proteins in same PDB: d2xokd1, d2xokd2, d2xoke1, d2xoke2, d2xokf1, d2xokf2, d2xokg_ automated match to d2jdid1 complexed with anp, mg |
PDB Entry: 2xok (more details), 3.01 Å
SCOPe Domain Sequences for d2xokd3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xokd3 a.69.1.0 (D:358-476) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ldaavvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqp favaevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaae
Timeline for d2xokd3: