Lineage for d2xnua_ (2xnu A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2819475Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2819476Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2819945Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 2819946Protein automated matches [193506] (5 species)
    not a true protein
  7. 2819947Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (67 PDB entries)
  8. 2820378Domain d2xnua_: 2xnu A: [244540]
    automated match to d2c9ta_
    complexed with vu3

Details for d2xnua_

PDB Entry: 2xnu (more details), 2.55 Å

PDB Description: acetylcholine binding protein (achbp) as template for hierarchical in silico screening procedures to identify structurally novel ligands for the nicotinic receptors
PDB Compounds: (A:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d2xnua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xnua_ b.96.1.0 (A:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
qanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkvdsstnevdlvyyeqqrwkl
nslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqr
lsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqt
rqvqhysccpepyidvnlvvkfrer

SCOPe Domain Coordinates for d2xnua_:

Click to download the PDB-style file with coordinates for d2xnua_.
(The format of our PDB-style files is described here.)

Timeline for d2xnua_: