SCOPe 2.04: Domain d2xhna3: 2xhn A:338-508

Lineage for d2xhna3 (2xhn A:338-508)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families)

5. Family b.18.1.0: automated matches [191481] (1 protein)
   not a true family

6. Protein automated matches [190770] (24 species)
   not a true protein

7. Species Fungus (Aspergillus aculeatus) [TaxId:5053] [255687] (1 PDB entry)

8. Domain d2xhna3: 2xhn A:338-508 [244513]
   Other proteins in same PDB: d2xhna1, d2xhna2, d2xhnb1, d2xhnb2
   automated match to d1nkga2
   complexed with ca, edo, so4; mutant

Details for d2xhna3

PDB Entry: 2xhn, 1.52 Å

PDB Description: rhamnogalacturonan lyase from aspergillus aculeatus k150a active site mutant

PDB Compounds: (A:) Rhamnogalacturonase B

SCOPe Domain Sequences for d2xhna3:

Sequence; same for both SEQRES and ATOM records:

>d2xhna3 b.18.1.0 (A:338-508) automated matches {Fungus (Aspergillus aculeatus) [TaxId: 5053]}
tgttifkigewdgqptgfrnaanqlrmhpsdsrmsswgpltytvgssaltdfpmavfksv
nnpvtikftatsaqtgaatlrigttlsfaggrpqatinsytgsapaaptnldsrgvtrga
yrglgevydvsipsgtivagtntitinvisgssgdtylspnfifdcvelfq

Timeline for d2xhna3:

• d2xhna3 is new in SCOPe 2.04-stable
  
• d2xhna3 appears in SCOPe 2.05
  
• d2xhna3 appears in the current release, SCOPe 2.08