![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
![]() | Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) ![]() |
![]() | Family b.3.1.0: automated matches [254199] (1 protein) not a true family |
![]() | Protein automated matches [254436] (4 species) not a true protein |
![]() | Species Fungus (Aspergillus aculeatus) [TaxId:5053] [255686] (1 PDB entry) |
![]() | Domain d2xhna2: 2xhn A:251-337 [244512] Other proteins in same PDB: d2xhna1, d2xhna3, d2xhnb1, d2xhnb3 automated match to d1nkga1 complexed with ca, edo, so4; mutant |
PDB Entry: 2xhn (more details), 1.52 Å
SCOPe Domain Sequences for d2xhna2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xhna2 b.3.1.0 (A:251-337) automated matches {Fungus (Aspergillus aculeatus) [TaxId: 5053]} yvaasgrgkvagtasgadssmdwvvhwyndaaqywtytsssgsftspamkpgtytmvyyq geyavatssvtvsagstttknisgsvk
Timeline for d2xhna2: