SCOPe 2.08: Domain d2xgpa2: 2xgp A:390-510

Lineage for d2xgpa2 (2xgp A:390-510)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
   beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology

4. Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families)

5. Family d.240.1.0: automated matches [231323] (1 protein)
   not a true family

6. Protein automated matches [231324] (5 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [231491] (7 PDB entries)

8. Domain d2xgpa2: 2xgp A:390-510 [244504]
   Other proteins in same PDB: d2xgpa1, d2xgpa3, d2xgpb1, d2xgpb3
   automated match to d2wtfa2
   protein/DNA complex; complexed with ca

Details for d2xgpa2

PDB Entry: 2xgp, 2.7 Å

PDB Description: yeast dna polymerase eta in complex with c8-2-acetylaminofluorene containing dna

PDB Compounds: (A:) DNA Polymerase ETA

SCOPe Domain Sequences for d2xgpa2:

Sequence; same for both SEQRES and ATOM records:

>d2xgpa2 d.240.1.0 (A:390-510) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pvvksmmsnknlrgkscnsivdciswlevfcaeltsriqdleqeynkiviprtvsislkt
ksyevyrksgpvaykginfqshellkvgikfvtdldikgknksyypltklsmtitnfdii
d

Timeline for d2xgpa2:

• d2xgpa2 first appeared in SCOPe 2.04
  
• d2xgpa2 appears in SCOPe 2.07