Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.12: TrpR-like [48295] (4 families) contains an extra shared helix after the HTH motif |
Family a.4.12.1: Trp repressor, TrpR [48296] (2 proteins) intertwined dimer of identical 6-helical subunits automatically mapped to Pfam PF01371 |
Protein automated matches [254650] (2 species) not a true protein |
Species Escherichia coli [TaxId:562] [255682] (1 PDB entry) |
Domain d2xdia_: 2xdi A: [244490] automated match to d1co0a_ mutant |
PDB Entry: 2xdi (more details)
SCOPe Domain Sequences for d2xdia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xdia_ a.4.12.1 (A:) automated matches {Escherichia coli [TaxId: 562]} qspysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvriveellr gemsqrelknefgagiatitrgsnslkaapvelrqwleevllksd
Timeline for d2xdia_: