Lineage for d2xdia_ (2xdi A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695732Superfamily a.4.12: TrpR-like [48295] (4 families) (S)
    contains an extra shared helix after the HTH motif
  5. 2695733Family a.4.12.1: Trp repressor, TrpR [48296] (2 proteins)
    intertwined dimer of identical 6-helical subunits
    automatically mapped to Pfam PF01371
  6. 2695778Protein automated matches [254650] (4 species)
    not a true protein
  7. 2695779Species Escherichia coli [TaxId:562] [255682] (2 PDB entries)
  8. 2695781Domain d2xdia_: 2xdi A: [244490]
    automated match to d1co0a_
    mutant

Details for d2xdia_

PDB Entry: 2xdi (more details)

PDB Description: Tryptophan repressor with L75F mutation in its apo form (no L- tryptophan bound)
PDB Compounds: (A:) trp operon repressor

SCOPe Domain Sequences for d2xdia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xdia_ a.4.12.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
qspysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvriveellr
gemsqrelknefgagiatitrgsnslkaapvelrqwleevllksd

SCOPe Domain Coordinates for d2xdia_:

Click to download the PDB-style file with coordinates for d2xdia_.
(The format of our PDB-style files is described here.)

Timeline for d2xdia_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2xdib_