SCOPe 2.08: Domain d2xdia_: 2xdi A:

Lineage for d2xdia_ (2xdi A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.12: TrpR-like [48295] (4 families)
   contains an extra shared helix after the HTH motif

5. Family a.4.12.1: Trp repressor, TrpR [48296] (2 proteins)
   intertwined dimer of identical 6-helical subunits
   automatically mapped to Pfam PF01371

6. Protein automated matches [254650] (4 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [255682] (2 PDB entries)

8. Domain d2xdia_: 2xdi A: [244490]
   automated match to d1co0a_
   mutant

Details for d2xdia_

PDB Entry: 2xdi

PDB Description: Tryptophan repressor with L75F mutation in its apo form (no L- tryptophan bound)

PDB Compounds: (A:) trp operon repressor

SCOPe Domain Sequences for d2xdia_:

Sequence; same for both SEQRES and ATOM records:

>d2xdia_ a.4.12.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
qspysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvriveellr
gemsqrelknefgagiatitrgsnslkaapvelrqwleevllksd

Timeline for d2xdia_:

• d2xdia_ first appeared in SCOPe 2.04
  
• d2xdia_ appears in SCOPe 2.07