SCOPe 2.08: Domain d2xd2a_: 2xd2 A:

Lineage for d2xd2a_ (2xd2 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Streptococcus pneumoniae [TaxId:170187] [226722] (3 PDB entries)

8. Domain d2xd2a_: 2xd2 A: [244485]
   automated match to d2fnca_

Details for d2xd2a_

PDB Entry: 2xd2, 2.9 Å

PDB Description: the crystal structure of malx from streptococcus pneumoniae

PDB Compounds: (A:) maltose/maltodextrin-binding protein

SCOPe Domain Sequences for d2xd2a_:

Sequence; same for both SEQRES and ATOM records:

>d2xd2a_ c.94.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
keltvyvdegyksyieevakayekeagvkvtlktgdalggldklsldnqngnvpdvmmap
ydrvgslgsdgqlsevklsdgaktddttkslvtaangkvygapavieslvmyynkdlvkd
apktfadlenlakdskyafagedgkttafladwtnfyytygllagngayvfgqngkdakd
iglandgsivginyakswyekwpkgmqdtegagnliqtqfqegktaaiidgpwkaqafkd
akvnygvatiptlpngkeyaafgggkawvipqavknleasqkfvdflvateqqkvlydkt
neipantearsyaegkndelttavikqfkntqplpnisqmsavwdpaknmlfdavsgqkd
aktaandavtliketlkqk

Timeline for d2xd2a_:

• d2xd2a_ first appeared in SCOPe 2.04
  
• d2xd2a_ appears in SCOPe 2.07